PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009786397.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 262aa    MW: 28982.8 Da    PI: 8.1192
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009786397.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.84.8e-382786261
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                    + +a+kcprCds ntkfCyynny+lsqPr+fC++CrryWtkGG lrnvPvGgg+rk+++s
  XP_009786397.1 27 QPQAIKCPRCDSLNTKFCYYNNYNLSQPRHFCQSCRRYWTKGGILRNVPVGGGCRKSRRS 86
                    56899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-272585IPR003851Zinc finger, Dof-type
PfamPF027012.0E-322985IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0123185IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103369IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MQDIHSIGGG GGRFYGGGGD RRLRLNQPQA IKCPRCDSLN TKFCYYNNYN LSQPRHFCQS  60
CRRYWTKGGI LRNVPVGGGC RKSRRSKPKP SAVSTTDDTS QENKSNSNSN SNSGSESSSL  120
TAITSTAAAA ANTSVAMTPE FVLGNSSNPT LPDVQDSRFL VTETTKGDFI QQVVGRHTTE  180
EQIFHDIGDY PINVNNISMY QNSNAGFFDR TAHVELSGRR ANDGGLAPVD WQTGGLFGMV  240
ENSDLQYSYW YQRQWGENDH YF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11018GGRFYGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755182e-46HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009786397.10.0PREDICTED: dof zinc finger protein DOF5.4-like
TrEMBLF6GTE93e-53F6GTE9_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g04850.t018e-53(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1695345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.11e-37OBF binding protein 4